Home > Product > Antimicrobial Peptides > Antibacterial protein LL-37

Antimicrobial Peptides

Antibacterial protein LL-37

Price Inquiry
CAT#
AF2677
Sequence
SLGNFFRKARKKIGEEFKRIVQRIKDFLQHLIPRTEA
Host Chemicals
Hylobates moloch
Length
37
Activity
Antibacterial
SwissProt ID
Q1KLX8

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.