Home > Product > Antimicrobial Peptides > Antibacterial protein LL-37

Antimicrobial Peptides

Antibacterial protein LL-37

[Price Inquiry]
CAT#
AF2677
Sequence
SLGNFFRKARKKIGEEFKRIVQRIKDFLQHLIPRTEA
Host Chemicals
Hylobates moloch
Length
37
Activity
Antibacterial
SwissProt ID
Q1KLX8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.