Keywords Search Google Search Search

Antibacterial protein1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3105
Sequence	MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF101	PG-SPI	Inquiry
AF768	Chrysophsin-3	Inquiry
AF2736	CRS4C-2	Inquiry
AF3254	PhD2	Inquiry
AF3122	Temporin-MT3 antimicrobial peptide precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Montirelin: a thyrotropin-releasing hormone analogue

Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...

The mechanism and function of acetyl tetrapeptide-2 in human skin

Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...

Function of Urantide in the Rat Aorta

Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Staphylococcus haemolyticus
Length	44
SwissProt ID	P11697