Home > Product > Antimicrobial Peptides > Antibacterial protein1

Antimicrobial Peptides

Antibacterial protein1

[Price Inquiry]
CAT#
AF3105
Sequence
MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF
Host Chemicals
Staphylococcus haemolyticus
Length
44
Activity
Antibacterial
SwissProt ID
P11697
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.