Home > Product > Antimicrobial Peptides > Antibiotic peptide cecropin B2

Antimicrobial Peptides

Antibiotic peptide cecropin B2

[Price Inquiry]
CAT#
AF2416
Sequence
GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG
Host Chemicals
Aedes albopictus
Length
35
Activity
Antibacterial
SwissProt ID
Q963A9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.