Home > Product > Antimicrobial Peptides > Antifungal protein precursor

Antimicrobial Peptides

Antifungal protein precursor

Price Inquiry
CAT#
AF3170
Sequence
RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC
Host Chemicals
Medicago sativa
Length
45
Activity
Antifungal
SwissProt ID
Q9FPM3

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.