Home > Product > Antimicrobial Peptides > Antifungal protein precursor

Antimicrobial Peptides

Antifungal protein precursor

[Price Inquiry]
CAT#
AF3170
Sequence
RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC
Host Chemicals
Medicago sativa
Length
45
Activity
Antifungal
SwissProt ID
Q9FPM3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.