Home > Product > Antimicrobial Peptides > Antifungal protein R

Antimicrobial Peptides

Antifungal protein R

[Price Inquiry]
CAT#
AF3057
Sequence
ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV
Host Chemicals
Hordeum vulgare
Length
44
Activity
Antifungal
SwissProt ID
P33044
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.