Home > Product > Antimicrobial Peptides > Antifungal protein R

Antimicrobial Peptides

Antifungal protein R

Price Inquiry
CAT#
AF3057
Sequence
ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV
Host Chemicals
Hordeum vulgare
Length
44
Activity
Antifungal
SwissProt ID
P33044

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.