Home > Product > Antimicrobial Peptides > Antihypertensive protein BDS-1

Antimicrobial Peptides

Antihypertensive protein BDS-1

[Price Inquiry]
CAT#
AF2973
Sequence
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
Host Chemicals
Anemonia sulcata
Length
43
Activity
Antiviral
SwissProt ID
P11494
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.