Home > Product > Antimicrobial Peptides > Antimicrobial peptide 1a

Antimicrobial Peptides

Antimicrobial peptide 1a

[Price Inquiry]
CAT#
AF2956
Sequence
QKCGEQGRGAKCPNCLCCGRYGFCGSTPDYCGVGCQSQCRGC
Host Chemicals
Leymus arenarius
Length
42
Activity
Antimicrobial
SwissProt ID
P86521
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.