Home > Product > Antimicrobial Peptides > Antimicrobial peptide Alo-2

Antimicrobial Peptides

Antimicrobial peptide Alo-2

[Price Inquiry]
CAT#
AF2340
Sequence
CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR
Host Chemicals
Acrocinus longimanus
Length
34
Activity
Antifungal
SwissProt ID
P83652
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.