Home > Product > Antimicrobial Peptides > Antimicrobial peptide Alo-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial peptide Alo-1

[Price Inquiry]
CAT#
AF2341
Sequence
CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR
Host Chemicals
Acrocinus longimanus
Length
34
Activity
Antifungal
SwissProt ID
P83651
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.