Home > Product > Antimicrobial Peptides > Antimicrobial peptide Alo-3

Antimicrobial Peptides

Antimicrobial peptide Alo-3

[Price Inquiry]
CAT#
AF2479
Sequence
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
Host Chemicals
Acrocinus longimanus
Length
36
Activity
Antifungal
SwissProt ID
P83653
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.