Home > Product > Antimicrobial Peptides > Antimicrobial peptide Ar-AMP

Antimicrobial Peptides

Antimicrobial peptide Ar-AMP

[Price Inquiry]
CAT#
AF1868
Sequence
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
Host Chemicals
Amaranthus retroflexus
Length
30
Activity
Antifungal
SwissProt ID
Q5I2B2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.