Home > Product > Antimicrobial Peptides > Antimicrobial peptide C22 precursor

Antimicrobial Peptides

Antimicrobial peptide C22 precursor

[Price Inquiry]
CAT#
AF3087
Sequence
GIWSWIKKTAKKVWNSDVAKKLKGKALNVAKDFVAEKIGATPAE
Host Chemicals
Urodacus yaschenkoi
Length
44
Activity
Antimicrobial
SwissProt ID
L0GBQ6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.