Home > Product > Antimicrobial Peptides > Antimicrobial peptide defensin 3

Antimicrobial Peptides

Antimicrobial peptide defensin 3

[Price Inquiry]
CAT#
AF3163
Sequence
QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT
Host Chemicals
Anopheles gambiae
Length
45
Activity
Antimicrobial
SwissProt ID
Q5TWR9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.