Home > Product > Antimicrobial Peptides > Antimicrobial peptide ISAMP

Antimicrobial Peptides

Antimicrobial peptide ISAMP

[Price Inquiry]
CAT#
AF3131
Sequence
DPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR
Host Chemicals
Ixodes scapularis
Length
45
Activity
Antibacterial
SwissProt ID
Q8MVA6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.