Home > Product > Antimicrobial Peptides > Antimicrobial peptide

Antimicrobial Peptides

Antimicrobial peptide

[Price Inquiry]
CAT#
AF2886
Sequence
IKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYE
Host Chemicals
Bacillus amyloliquefaciens Y2
Length
41
Activity
Antimicrobial
SwissProt ID
I2C153
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.