Home > Product > Antimicrobial Peptides > Antimicrobial peptide, Lci

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial peptide, Lci

[Price Inquiry]
CAT#
AF2921
Sequence
AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYE
Host Chemicals
Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Length
42
Activity
Antimicrobial
SwissProt ID
M1X8G7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.