Home > Product > Catalog Peptides > Others > Antimicrobial peptide lumbricin-1

Others

Antimicrobial peptide lumbricin-1

[Price Inquiry]
CAT#
L12001
Sequence
FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA
Length
62
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.