Home > Product > Antimicrobial Peptides > Antimicrobial peptide OGC1

Antimicrobial Peptides

Antimicrobial peptide OGC1

Price Inquiry
CAT#
AF2974
Sequence
AIGNILKTLGNLAQKILGKQPKMLKLWKWNWKSSDVEYHLAKC
Host Chemicals
Rana grahami
Length
43
Activity
Antimicrobial
SwissProt ID
C3RTH6

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.