Home > Product > Antimicrobial Peptides > Antimicrobial peptide OGC1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial peptide OGC1

[Price Inquiry]
CAT#
AF2974
Sequence
AIGNILKTLGNLAQKILGKQPKMLKLWKWNWKSSDVEYHLAKC
Host Chemicals
Rana grahami
Length
43
Activity
Antimicrobial
SwissProt ID
C3RTH6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.