Home > Product > Antimicrobial Peptides > Antimicrobial protein CAP18

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial protein CAP18

[Price Inquiry]
CAT#
AF2630
Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY
Host Chemicals
Oryctolagus cuniculus
Length
37
Activity
Antibacterial
SwissProt ID
P25230
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.