Home > Product > Antimicrobial Peptides > Antimicrobial protein CAP18

Antimicrobial Peptides

Antimicrobial protein CAP18

[Price Inquiry]
CAT#
AF2630
Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY
Host Chemicals
Oryctolagus cuniculus
Length
37
Activity
Antibacterial
SwissProt ID
P25230
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.