Home > Product > Antimicrobial Peptides > Antimicrobial protein plp

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Antimicrobial protein plp

[Price Inquiry]
CAT#
AF2950
Sequence
MKWTAAFLVLVIVVLMAQPGECFLGLIFHGLVHAGKLIHGLI
Host Chemicals
Hippocampus kuda
Length
42
Activity
Antimicrobial
SwissProt ID
A0PI25
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.