Antimicrobial Peptides

CAT#
AF3239
Sequence
TYMPVEEGEYIVNISYADQPKKNSPFTAKKQPGPKVDLSGVKAYGPG
Host Chemicals
Argopecten purpuratus
Length
47
Activity
Gram+, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.