Home > Product > Catalog Peptides > Others > Apelin-36, bovine

Others

Apelin-36, bovine

[Price Inquiry]
CAT#
A22007
Sequence
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
M.W/Mr.
4178.9
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.