Home > Product > Antimicrobial Peptides > Apl-AvBD16

Antimicrobial Peptides

Apl-AvBD16

[Price Inquiry]
CAT#
AF3260
Sequence
FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG
Host Chemicals
Peking duck, Anas platyrhynchos
Length
50
Activity
Gram+ & Gram-, Virus,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.