Home > Product > Antimicrobial Peptides > Apl-AvBD16

Antimicrobial Peptides

Apl-AvBD16

Price Inquiry
CAT#
AF3260
Sequence
FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG
Host Chemicals
Peking duck, Anas platyrhynchos
Length
50
Activity
Gram+ & Gram-, Virus,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.