CAT# | AF2678 |
Sequence | SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRW |
Activity | Antibacterial |
Host Chemicals | Hyas araneus | Length | 37 | SwissProt ID | A6XMY0 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF071 | Non - disulfide - bridged peptide 5.6 | Inquiry | ||
AF831 | Maximin H2 | Inquiry | ||
AF524 | CPF-C1 | Inquiry | ||
AF1456 | Caerin 2.6 | Inquiry | ||
AF678 | Phylloseptin-J2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Cationic cell-penetrating peptides are potent furin inhibitors
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...