Home > Product > Antimicrobial Peptides > Arasin-1

Antimicrobial Peptides

CAT#
AF2678
Sequence
SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRW
Host Chemicals
Hyas araneus
Length
37
Activity
Antibacterial
SwissProt ID
A6XMY0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.