Home > Product > Antimicrobial Peptides > Arasin-likeSp

Antimicrobial Peptides

Arasin-likeSp

[Price Inquiry]
CAT#
AF2912
Sequence
SPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG
Host Chemicals
Scylla paramamosain
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.