Antimicrobial Peptides

CAT#
AF2868
Sequence
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCW
Host Chemicals
Archaeoprepona demophoon
Length
41
Activity
Antimicrobial
SwissProt ID
P84156
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.