Home > Product > Catalog Peptides > β-Amyloid Mutations > [Arg13] b-Amyloid (1-40)

β-Amyloid Mutations

[Arg13] b-Amyloid (1-40)

[Price Inquiry]
CAT#
A13282
Sequence
DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4349.0
Molecular Formula
C194H300N54O58S1
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.