Home > Product > Antimicrobial Peptides > Arminin-1a

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Arminin-1a

[Price Inquiry]
CAT#
AF2052
Sequence
KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK
Host Chemicals
Hydra magnipapillata
Length
31
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.