Keywords Search Google Search Search

[Asn23]-beta-amyloid (1-42), Iowa Mutation

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13302
M.W/Mr.	4513.1
Sequence	DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA

CAT#	Product Name	Inquiry
CAD-005	Amyloid β-Protein (1-40) S26C	Inquiry
A13271	[Asn23]-beta-Amyloid (1-40), Iowa Mutation	Inquiry
A13305	[Lys22]-beta-Amyloid (1-42), Italian Mutation	Inquiry
A13301	[Gly21]-beta-Amyloid (1-42), A21G Flemish Mutation	Inquiry
CAD-003	(Arg3)-Amyloid β-Protein (1-40)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Cyclotraxin B, A Selective Antagonist of TrkB Receptors

Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...

A new kind of glycopeptide antibiotics–Ramoplanin

Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: