Home > Product > Catalog Peptides > β-Amyloid Mutations > [Asn7]-beta-Amyloid (1-40), Tottori-Japan Mutation

β-Amyloid Mutations

[Asn7]-beta-Amyloid (1-40), Tottori-Japan Mutation

[Price Inquiry]
CAT#
A13270
Sequence
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4328.9
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.