Home > Product > Antimicrobial Peptides > Astacidin

Antimicrobial Peptides

CAT#
AF3019
Sequence
MRLLHLLLSVALVALMAAVPSQASNGYRPAYRPAYRPSYRPGK
Host Chemicals
Procambarus clarkii
Length
43
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.