Home > Product > Antimicrobial Peptides > At-AFP1

Antimicrobial Peptides

CAT#
AF3267
Sequence
KLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
A thaliana
Length
50
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.