Home > Product > Catalog Peptides > Others > Atrial gland peptide B

Others

Atrial gland peptide B

[Price Inquiry]
CAT#
E12009
Sequence
AVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPI
Modifications
Isoleucine amide
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.