Home > Product > Catalog Peptides > Others > Attractin

Others

CAT#
A40001
Sequence
DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ
Modifications
N-linked (GlcNAc...);Disulfide bond(3)
Length
56
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.