Home > Product > Antimicrobial Peptides > AvBD10

Antimicrobial Peptides

CAT#
AF3314
Sequence
VLLFLFQAAPGSADAPFADTAACRSQGNFCRAGACPPTFAASGSCHGGLLNCCAK
Host Chemicals
liver, Peking duck, Anas platyrhynchos
Length
55
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.