β-Amyloid (1-42), (1-40), (1-46) and Fragments

b-Amyloid (42-1)

[Price Inquiry]
CAT#
A13307
Sequence
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
M.W/Mr.
4514.4
Molecular Formula
C203H311N55O60S1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.