Home > Product > Antimicrobial Peptides > B-defensin2-like protein 4

Antimicrobial Peptides

B-defensin2-like protein 4

[Price Inquiry]
CAT#
AF2526
Sequence
NPVTCLRSGAICHPGFCPRRYKHIGVCGVSAIKCCK
Host Chemicals
Macaca mulatta
Length
36
Activity
Antimicrobial
SwissProt ID
B0LFF6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.