Antimicrobial Peptides

CAT#
AF2536
Sequence
RRLHPQHQRFPRERPWPKPLSLPLPRPGPRPWPKPL
Host Chemicals
Bos primigenius
Length
36
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.