Home > Product > Antimicrobial Peptides > Bactericidin B-5P

Antimicrobial Peptides

Bactericidin B-5P

[Price Inquiry]
CAT#
AF2553
Sequence
WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARG
Host Chemicals
Manduca sexta
Length
36
Activity
Antimicrobial
SwissProt ID
P14665
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.