Home > Product > Antimicrobial Peptides > Bactericidin B-4

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bactericidin B-4

[Price Inquiry]
CAT#
AF2686
Sequence
WNPFKELERAGQRVRDAIISAAPAVATVGQAAAIARG
Host Chemicals
Manduca sexta
Length
37
Activity
Antibacterial
SwissProt ID
P14664
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.