Home > Product > Antimicrobial Peptides > Bactericidin B-2

Antimicrobial Peptides

Bactericidin B-2

[Price Inquiry]
CAT#
AF2689
Sequence
WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG
Host Chemicals
Manduca sexta
Length
37
Activity
Antibacterial
SwissProt ID
P14662
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.