Home > Product > Antimicrobial Peptides > Bacteriocin As-48

Antimicrobial Peptides

Bacteriocin As-48

Price Inquiry
CAT#
AF1870
Sequence
AKEFGIPAAVAGTVLNVVEAGGWVTTIVSI
Host Chemicals
Enterococcus faecalis
Length
30
Activity
Antibacterial
SwissProt ID
Q47765

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.