Home > Product > Antimicrobial Peptides > Bacteriocin As-48

Antimicrobial Peptides

Bacteriocin As-48

[Price Inquiry]
CAT#
AF1870
Sequence
AKEFGIPAAVAGTVLNVVEAGGWVTTIVSI
Host Chemicals
Enterococcus faecalis
Length
30
Activity
Antibacterial
SwissProt ID
Q47765
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.