Home > Product > Antimicrobial Peptides > Bacteriocin bavaricin-MN

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin bavaricin-MN

[Price Inquiry]
CAT#
AF2966
Sequence
TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK
Host Chemicals
Lactobacillus sakei
Length
42
Activity
Antimicrobial
SwissProt ID
P80493
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.