CAT# | AF2966 |
Sequence | TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK |
Activity | Antimicrobial |
Host Chemicals | Lactobacillus sakei | Length | 42 | SwissProt ID | P80493 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF814 | Maximin-H13 | Inquiry | ||
AF587 | Melectin | Inquiry | ||
AF722 | Witch flounder GC3.8-t | Inquiry | ||
AF3012 | Enterocin-HF | Inquiry | ||
AF1208 | Isracidin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. The spatiotemporal control of signalling and trafficking of the GLP-1R
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. High fat diet and GLP-1 drugs induce pancreatic injury in mice
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...