Home > Product > Antimicrobial Peptides > Bacteriocin carnobacteriocin BM1

Antimicrobial Peptides

Bacteriocin carnobacteriocin BM1

Price Inquiry
CAT#
AF2975
Sequence
AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
Host Chemicals
Carnobacterium maltaromaticum
Length
43
Activity
Antibacterial
SwissProt ID
P38579

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.