Home > Product > Antimicrobial Peptides > Bacteriocin carnobacteriocin BM1

Antimicrobial Peptides

Bacteriocin carnobacteriocin BM1

[Price Inquiry]
CAT#
AF2975
Sequence
AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
Host Chemicals
Carnobacterium maltaromaticum
Length
43
Activity
Antibacterial
SwissProt ID
P38579
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.