CAT# | AF2975 |
Sequence | AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH |
Activity | Antibacterial |
Host Chemicals | Carnobacterium maltaromaticum | Length | 43 | SwissProt ID | P38579 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2874 | Tachystatin C | Inquiry | ||
AF1009 | Nigroain-K1 | Inquiry | ||
AF3198 | Esculentin-1-OA1 | Inquiry | ||
AF498 | Ranatuerin-2R | Inquiry | ||
AF2514 | MMGP1 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...