Home > Product > Antimicrobial Peptides > Bacteriocin curvacin-A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin curvacin-A

[Price Inquiry]
CAT#
AF2866
Sequence
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
Host Chemicals
Lactobacillus curvatus
Length
41
Activity
Antibacterial
SwissProt ID
P0A311
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.