Home > Product > Antimicrobial Peptides > Bacteriocin curvacin-A

Antimicrobial Peptides

Bacteriocin curvacin-A

Price Inquiry
CAT#
AF2866
Sequence
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
Host Chemicals
Lactobacillus curvatus
Length
41
Activity
Antibacterial
SwissProt ID
P0A311

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.