Home > Product > Antimicrobial Peptides > Bacteriocin divergicin M35

Antimicrobial Peptides

Bacteriocin divergicin M35

[Price Inquiry]
CAT#
AF3037
Sequence
TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC
Host Chemicals
Carnobacterium divergens
Length
43
Activity
Antibacterial
SwissProt ID
P84962
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.