Home > Product > Antimicrobial Peptides > Bacteriocin E50-52

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin E50-52

[Price Inquiry]
CAT#
AF2800
Sequence
TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA
Host Chemicals
Enterococcus faecium
Length
39
Activity
Antibacterial
SwissProt ID
P85148
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.