Home > Product > Antimicrobial Peptides > Bacteriocin hiracin-JM79

Antimicrobial Peptides

Bacteriocin hiracin-JM79

[Price Inquiry]
CAT#
AF3059
Sequence
ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR
Host Chemicals
Enterococcus hirae
Length
44
Activity
Antibacterial
SwissProt ID
Q0Z8B6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.