Home > Product > Antimicrobial Peptides > Bacteriocin L-1077

Antimicrobial Peptides

Bacteriocin L-1077

[Price Inquiry]
CAT#
AF2682
Sequence
TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT
Host Chemicals
Lactobacillus salivarius 1077 (NRRL B-50053)
Length
37
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.