Home > Product > Antimicrobial Peptides > Bacteriocin lactocin-705

Antimicrobial Peptides

Bacteriocin lactocin-705

[Price Inquiry]
CAT#
AF2026
Sequence
GMSGYIQGIPDFLKGYLHGISAANKHKKGRL
Host Chemicals
Lactobacillus paracasei
Length
31
Activity
Antibacterial
SwissProt ID
P80959
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.